NPTN anticorps (Middle Region)
-
- Antigène Voir toutes NPTN Anticorps
- NPTN (Neuroplastin (NPTN))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NPTN est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- Neuroplastin antibody was raised against the middle region of NPTN
- Purification
- Purified
- Immunogène
- Neuroplastin antibody was raised using the middle region of NPTN corresponding to a region with amino acids MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN
- Top Product
- Discover our top product NPTN Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Neuroplastin Blocking Peptide, catalog no. 33R-5985, is also available for use as a blocking control in assays to test for specificity of this Neuroplastin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPTN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NPTN (Neuroplastin (NPTN))
- Autre désignation
- Neuroplastin (NPTN Produits)
- Synonymes
- anticorps SDFR1, anticorps GP55, anticorps GP65, anticorps SDR1, anticorps np55, anticorps np65, anticorps AW554172, anticorps Sdfr1, anticorps nptn, anticorps zgc:77326, anticorps neuroplastin, anticorps neuroplastin L homeolog, anticorps neuroplastin b, anticorps NPTN, anticorps Nptn, anticorps nptn.L, anticorps nptnb
- Sujet
- Neuroplastin is a type I transmembrane protein belonging to the Ig superfamily. The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. The alpha and beta transcripts show differential localization within the brain.
- Poids moléculaire
- 42 kDa (MW of target protein)
- Pathways
- Regulation of long-term Neuronal Synaptic Plasticity
-