NPTN anticorps (Middle Region)

N° du produit ABIN630447

Détail du produit anti-NPTN anticorps

Antigène: NPTN (Neuroplastin (NPTN))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NPTN est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: Neuroplastin antibody was raised against the middle region of NPTN

Purification: Purified

Immunogène: Neuroplastin antibody was raised using the middle region of NPTN corresponding to a region with amino acids MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Neuroplastin Blocking Peptide, catalog no. 33R-5985, is also available for use as a blocking control in assays to test for specificity of this Neuroplastin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NPTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NPTN

Antigène: NPTN (Neuroplastin (NPTN))

Autre désignation: Neuroplastin (NPTN Produits)

Synonymes: anticorps SDFR1, anticorps GP55, anticorps GP65, anticorps SDR1, anticorps np55, anticorps np65, anticorps AW554172, anticorps Sdfr1, anticorps nptn, anticorps zgc:77326, anticorps neuroplastin, anticorps neuroplastin L homeolog, anticorps neuroplastin b, anticorps NPTN, anticorps Nptn, anticorps nptn.L, anticorps nptnb

Sujet: Neuroplastin is a type I transmembrane protein belonging to the Ig superfamily. The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. The alpha and beta transcripts show differential localization within the brain.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Regulation of long-term Neuronal Synaptic Plasticity