ST3GAL5 anticorps (N-Term)

N° du produit ABIN630451

Détail du produit anti-ST3GAL5 anticorps

Antigène: ST3GAL5 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 5 (ST3GAL5))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ST3GAL5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: ST3 GAL5 antibody was raised against the N terminal of ST3 AL5

Purification: Purified

Immunogène: ST3 GAL5 antibody was raised using the N terminal of ST3 AL5 corresponding to a region with amino acids DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ST3GAL5 Blocking Peptide, catalog no. 33R-2160, is also available for use as a blocking control in assays to test for specificity of this ST3GAL5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 AL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ST3GAL5

Antigène: ST3GAL5 (ST3 beta-Galactoside alpha-2,3-Sialyltransferase 5 (ST3GAL5))

Autre désignation: ST3GAL5 (ST3GAL5 Produits)

Synonymes: anticorps SATI, anticorps SIAT9, anticorps SIATGM3S, anticorps ST3GalV, anticorps ST3GAL-V, anticorps 3S-T, anticorps Siat9, anticorps [a]2, anticorps ST3 beta-galactoside alpha-2,3-sialyltransferase 5, anticorps ST3GAL5, anticorps St3gal5

Sujet: Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. ST3GAL5 is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. It is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus. Mutation in its gene has been associated with Amish infantile epilepsy syndrome.

Poids moléculaire: 48 kDa (MW of target protein)