PIGV anticorps (N-Term)
-
- Antigène Voir toutes PIGV Anticorps
- PIGV (Phosphatidylinositol Glycan Anchor Biosynthesis, Class V (PIGV))
-
Épitope
- N-Term
-
Reactivité
- Humain, Chien, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PIGV est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- PIGV antibody was raised against the N terminal of PIGV
- Purification
- Purified
- Immunogène
- PIGV antibody was raised using the N terminal of PIGV corresponding to a region with amino acids FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE
- Top Product
- Discover our top product PIGV Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PIGV Blocking Peptide, catalog no. 33R-3111, is also available for use as a blocking control in assays to test for specificity of this PIGV antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGV antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PIGV (Phosphatidylinositol Glycan Anchor Biosynthesis, Class V (PIGV))
- Autre désignation
- PIGV (PIGV Produits)
- Synonymes
- anticorps GPI-MT-II, anticorps HPMRS1, anticorps PIG-V, anticorps B330013B03, anticorps D430024F16Rik, anticorps RGD1309526, anticorps phosphatidylinositol glycan anchor biosynthesis class V, anticorps zinc finger DHHC-type containing 18, anticorps phosphatidylinositol glycan anchor biosynthesis, class V, anticorps PIGV, anticorps ZDHHC18, anticorps Pigv
- Sujet
- Glycosylphosphatidylinositol (GPI) is a complex glycolipid that anchors many proteins to the cell surface. The biosynthetic pathway of GPI is mediated by sequential addition of sugars and other components to phosphatidylinositol. PIGV adds the second mannose to the GPI core.
- Poids moléculaire
- 56 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-