SSR2 anticorps

N° du produit ABIN630453

Détail du produit anti-SSR2 anticorps

Antigène: SSR2 (Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SSR2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: SSR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAA

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SSR2 Blocking Peptide, catalog no. 33R-8444, is also available for use as a blocking control in assays to test for specificity of this SSR2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SSR2

Antigène: SSR2 (Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2))

Autre désignation: SSR2 (SSR2 Produits)

Sujet: The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34 kDa glycoprotein (alpha-SSR or SSR1) and a 22 kDa glycoprotein (beta-SSR or SSR2).

Poids moléculaire: 20 kDa (MW of target protein)