SSR2 anticorps

N° du produit ABIN630453

Détail du produit anti-SSR2 anticorps

Antigène: SSR2 (Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2))

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SSR2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogène: SSR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFVVLALFAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAA

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SSR2 Blocking Peptide, catalog no. 33R-8444, is also available for use as a blocking control in assays to test for specificity of this SSR2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SSR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SSR2

Antigène: SSR2 (Signal Sequence Receptor, beta (Translocon-Associated Protein Beta) (SSR2))

Autre désignation: SSR2 (SSR2 Produits)

Synonymes: anticorps MUA22.2, anticorps MUA22_2, anticorps DDBDRAFT_0206509, anticorps DDBDRAFT_0266464, anticorps DDB_0206509, anticorps DDB_0266464, anticorps TRAP[b], anticorps TRAPb, anticorps wu:fb75b04, anticorps zgc:92180, anticorps 1500032E05Rik, anticorps AI315033, anticorps AU020133, anticorps TLAP, anticorps TRAPB, anticorps TRAPbeta, anticorps TRAP-BETA, anticorps gp25H, anticorps translocon-associated protein beta (TRAPB) family protein, anticorps translocon-associated protein subunit beta, anticorps Translocon-associated protein subunit beta, anticorps signal sequence receptor, beta, anticorps signal sequence receptor subunit 2, anticorps signal sequence receptor, beta (translocon-associated protein beta) L homeolog, anticorps AT5G14030, anticorps CpipJ_CPIJ005682, anticorps ssr2, anticorps ssrb, anticorps Ssr2, anticorps ssr2.L, anticorps SSR2

Sujet: The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34 kDa glycoprotein (alpha-SSR or SSR1) and a 22 kDa glycoprotein (beta-SSR or SSR2).

Poids moléculaire: 20 kDa (MW of target protein)