TM9SF1 anticorps (N-Term)

N° du produit ABIN630456

Détail du produit anti-TM9SF1 anticorps

Antigène: TM9SF1 (Transmembrane 9 Superfamily Member 1 (TM9SF1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TM9SF1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: TM9 SF1 antibody was raised against the N terminal of TM9 F1

Purification: Purified

Immunogène: TM9 SF1 antibody was raised using the N terminal of TM9 F1 corresponding to a region with amino acids EGVTHYKAGDPVILYVNKVGPYHNPQETYHYYQLPVCCPEKIRHKSLSLG

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TM9SF1 Blocking Peptide, catalog no. 33R-2450, is also available for use as a blocking control in assays to test for specificity of this TM9SF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TM9SF1

Antigène: TM9SF1 (Transmembrane 9 Superfamily Member 1 (TM9SF1))

Autre désignation: TM9SF1 (TM9SF1 Produits)

Synonymes: anticorps TM9SF1, anticorps fa03b09, anticorps wu:fa03b09, anticorps zgc:100810, anticorps HMP70, anticorps MP70, anticorps 1200014D02Rik, anticorps AI893436, anticorps transmembrane 9 superfamily member 1, anticorps transmembrane 9 superfamily member 1 L homeolog, anticorps TM9SF1, anticorps tm9sf1, anticorps tm9sf1.L, anticorps Tm9sf1

Sujet: TM9SF1 may function as channel, small molecule transporter or receptor.

Poids moléculaire: 67 kDa (MW of target protein)