M6PR anticorps
-
- Antigène Voir toutes M6PR Anticorps
- M6PR (Mannose-6-Phosphate Receptor (Cation Dependent) (M6PR))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp M6PR est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogène
- M6 PR antibody was raised using a synthetic peptide corresponding to a region with amino acids RLKPLFNKSFESTVGQGSDTYIYIFRVCREAGNHTSGAGLVQINKSNGKE
- Top Product
- Discover our top product M6PR Anticorps primaire
-
-
- Indications d'application
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
M6PR Blocking Peptide, catalog no. 33R-8035, is also available for use as a blocking control in assays to test for specificity of this M6PR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of M0 R antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- M6PR (Mannose-6-Phosphate Receptor (Cation Dependent) (M6PR))
- Autre désignation
- M6PR (M6PR Produits)
- Synonymes
- anticorps CD222, anticorps CIMPR, anticorps M6P-R, anticorps MPR1, anticorps MPRI, anticorps CD-MPR, anticorps MPR 46, anticorps MPR-46, anticorps MPR46, anticorps SMPR, anticorps Mpr46, anticorps CDMPR, anticorps m6pr, anticorps MGC68896, anticorps MGC130765, anticorps zgc:77757, anticorps wu:fj81h11, anticorps MGC89423, anticorps M6PR, anticorps mprd, anticorps C16orf27, anticorps GNPTAG, anticorps LP2537, anticorps RJD9, anticorps insulin like growth factor 2 receptor, anticorps mannose-6-phosphate receptor, cation dependent, anticorps mannose-6-phosphate receptor (cation dependent) L homeolog, anticorps mannose-6-phosphate receptor (cation dependent), anticorps mannose-6-phosphate receptor (cation dependent) S homeolog, anticorps Cation-dependent mannose-6-phosphate receptor, anticorps N-acetylglucosamine-1-phosphate transferase gamma subunit, anticorps IGF2R, anticorps M6PR, anticorps M6pr, anticorps m6pr.L, anticorps m6pr, anticorps m6pr.S, anticorps Ethha_1678, anticorps mprd, anticorps GNPTG
- Sujet
- M6PR is a receptor for mannose-6-phosphate groups on lysosomal enzymes. The receptor forms a homodimer or homotetramer for intracellular targeting of lysosomal enzymes and export of newly synthesized lysosomal enzymes into the cell secretions. The receptor is an integral membrane protein which localizes to the trans-Golgi reticulum, endosomes, and the plasma membrane.
- Poids moléculaire
- 28 kDa (MW of target protein)
-