Butyrylcholinesterase anticorps (N-Term)
-
- Antigène Voir toutes Butyrylcholinesterase (BCHE) Anticorps
- Butyrylcholinesterase (BCHE)
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Butyrylcholinesterase est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- BCHE antibody was raised against the N terminal of BCHE
- Purification
- Purified
- Immunogène
- BCHE antibody was raised using the N terminal of BCHE corresponding to a region with amino acids SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ
- Top Product
- Discover our top product BCHE Anticorps primaire
-
anti-Butyrylcholinesterase (BCHE) (AA 29-150) antibody
BCHE Reactivité: Humain WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Butyrylcholinesterase (BCHE) antibodyBCHE Reactivité: Humain, Souris, Rat WB, IHC, IF Hôte: Lapin Polyclonal unconjugated
anti-Butyrylcholinesterase (BCHE) antibodyBCHE Reactivité: Humain, Chien WB, FACS Hôte: Souris Monoclonal 1E1 unconjugated
anti-Butyrylcholinesterase (BCHE) (AA 311-524) antibodyBCHE Reactivité: Humain WB, ELISA, IF Hôte: Lapin Polyclonal unconjugated
anti-Butyrylcholinesterase (BCHE) (AA 505-602) antibodyBCHE Reactivité: Humain WB, ELISA, IF (p), IF (cc), IHC (p), IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-Butyrylcholinesterase (BCHE) antibodyBCHE Reactivité: Humain, Souris ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Butyrylcholinesterase (BCHE) antibodyBCHE Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Butyrylcholinesterase (BCHE) (AA 29-270) antibodyBCHE Reactivité: Humain WB Hôte: Lapin Polyclonal unconjugated
anti-Butyrylcholinesterase (BCHE) (AA 151-200) antibodyBCHE Reactivité: Humain, Souris, Chien, Mouton, Boeuf (Vache), Cheval, Roussette (Chauve-souris), Poulet WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Butyrylcholinesterase (BCHE) (N-Term) antibodyBCHE Reactivité: Humain, Souris, Chien, Rat, Mouton, Boeuf (Vache), Cheval, Cobaye, Porc, Lapin WB, IHC Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
BCHE Blocking Peptide, catalog no. 33R-8821, is also available for use as a blocking control in assays to test for specificity of this BCHE antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCHE antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Butyrylcholinesterase (BCHE)
- Autre désignation
- BCHE (BCHE Produits)
- Synonymes
- anticorps che, anticorps che1, anticorps bche, anticorps cholinesterase, anticorps CHE1, anticorps CHE2, anticorps E1, anticorps C730038G20Rik, anticorps butyrylcholinesterase L homeolog, anticorps butyrylcholinesterase, anticorps bche.L, anticorps bche, anticorps BCHE, anticorps Bche
- Sujet
- Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.
- Poids moléculaire
- 68 kDa (MW of target protein)
- Pathways
- Peptide Hormone Metabolism
-
