PLP2 anticorps

N° du produit ABIN630464

Détail du produit anti-PLP2 anticorps

Antigène: PLP2 (Proteolipid Protein 2 (PLP2))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PLP2 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: PLP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVERGNHSKIVAGVLGLIATCLFGYDAYVTFPVRQPRHTAAPTDPADGPV

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLP2 Blocking Peptide, catalog no. 33R-5507, is also available for use as a blocking control in assays to test for specificity of this PLP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PLP2

Antigène: PLP2 (Proteolipid Protein 2 (PLP2))

Autre désignation: PLP2 (PLP2 Produits)

Synonymes: anticorps A4, anticorps A4LSB, anticorps mIMA4, anticorps A4-LSB, anticorps a4lsb, anticorps plp2, anticorps proteolipid protein 2, anticorps proteolipid protein 2 S homeolog, anticorps PLP2, anticorps Plp2, anticorps plp2.S

Sujet: PLP2 may play a role in cell differentiation in the intestinal epithelium.

Poids moléculaire: 17 kDa (MW of target protein)