TMPRSS11D anticorps (N-Term)

N° du produit ABIN630466

Détail du produit anti-TMPRSS11D anticorps

Antigène: TMPRSS11D (Transmembrane Protease, serine 11D (TMPRSS11D))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMPRSS11D est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: TMPRSS11 D antibody was raised against the N terminal of TMPRSS11

Purification: Purified

Immunogène: TMPRSS11 D antibody was raised using the N terminal of TMPRSS11 corresponding to a region with amino acids RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMPRSS11D Blocking Peptide, catalog no. 33R-8213, is also available for use as a blocking control in assays to test for specificity of this TMPRSS11D antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMPRSS10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMPRSS11D

Antigène: TMPRSS11D (Transmembrane Protease, serine 11D (TMPRSS11D))

Autre désignation: TMPRSS11D (TMPRSS11D Produits)

Synonymes: anticorps HAT, anticorps AST, anticorps AsP, anticorps BC020151, anticorps Asp, anticorps Tmprss11d, anticorps transmembrane protease, serine 11D, anticorps transmembrane protease, serine 11d, anticorps transmembrane protease serine 11D, anticorps TMPRSS11D, anticorps Tmprss11d, anticorps LOC100720850

Sujet: TMPRSS11D is a trypsin-like serine protease released from the submucosal serous glands onto mucous membrane. It is a type II integral membrane protein and has 29-38% identity in the sequence of the catalytic region with human hepsin, enteropeptidase, acrosin, and mast cell tryptase. The noncatalytic region has little similarity to other known proteins. This protein may play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions.

Poids moléculaire: 46 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Regulation of Carbohydrate Metabolic Process