Calmegin anticorps (N-Term)

N° du produit ABIN630467

Détail du produit anti-Calmegin anticorps

Antigène: Calmegin (CLGN)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Calmegin est non-conjugé

Application: Western Blotting (WB)

Specificité: Calmegin antibody was raised against the N terminal of CLGN

Purification: Purified

Immunogène: Calmegin antibody was raised using the N terminal of CLGN corresponding to a region with amino acids YKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEEL

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Calmegin Blocking Peptide, catalog no. 33R-10157, is also available for use as a blocking control in assays to test for specificity of this Calmegin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLGN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Calmegin

Antigène: Calmegin (CLGN)

Autre désignation: Calmegin (CLGN Produits)

Synonymes: anticorps 4930459O04Rik, anticorps AI528775, anticorps Cln, anticorps canx, anticorps fj49d10, anticorps wu:fj24b04, anticorps wu:fj49d10, anticorps zgc:153946, anticorps CLGN, anticorps calmegin, anticorps CLGN, anticorps Clgn, anticorps clgn

Sujet: Calmegin is a testis-specific endoplasmic reticulum chaperone protein. CLGN may play a role in spermatogeneis and infertility.

Poids moléculaire: 70 kDa (MW of target protein)