MBOAT7 anticorps (C-Term)

N° du produit ABIN630475

Détail du produit anti-MBOAT7 anticorps

Antigène: MBOAT7 (Membrane Bound O-Acyltransferase Domain Containing 7 (MBOAT7))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MBOAT7 est non-conjugé

Application: Western Blotting (WB)

Specificité: LENG4 antibody was raised against the C terminal Of Leng4

Purification: Purified

Immunogène: LENG4 antibody was raised using the C terminal Of Leng4 corresponding to a region with amino acids LSAYWHGLHPGYYLSFLTIPLCLAAEGRLESALRGRLSPGGQKAWDWVHW

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LENG4 Blocking Peptide, catalog no. 33R-5412, is also available for use as a blocking control in assays to test for specificity of this LENG4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LENG4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MBOAT7

Antigène: MBOAT7 (Membrane Bound O-Acyltransferase Domain Containing 7 (MBOAT7))

Autre désignation: LENG4 (MBOAT7 Produits)

Synonymes: anticorps BB1, anticorps LENG4, anticorps LPIAT, anticorps LRC4, anticorps MBOA7, anticorps OACT7, anticorps hMBOA-7, anticorps 5730589L02Rik, anticorps Leng4, anticorps Lpiat, anticorps mBB1, anticorps RGD1306945, anticorps membrane bound O-acyltransferase domain containing 7, anticorps Lysophospholipid acyltransferase 7, anticorps MBOAT7, anticorps Mboat7, anticorps mboa-7

Sujet: The function of LENG4 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: Inositol Metabolic Process