VSIG4 anticorps (N-Term)

N° du produit ABIN630478

Détail du produit anti-VSIG4 anticorps

Antigène: VSIG4 (V-Set and Immunoglobulin Domain-Containing Protein 4 (VSIG4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp VSIG4 est non-conjugé

Application: Western Blotting (WB)

Specificité: VSIG4 antibody was raised against the N terminal of VSIG4

Purification: Purified

Immunogène: VSIG4 antibody was raised using the N terminal of VSIG4 corresponding to a region with amino acids VPGDVSLQLSTLEMDDRSHYTCEVTWQTPDGNQVVRDKITELRVQKLSVS

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

VSIG4 Blocking Peptide, catalog no. 33R-9726, is also available for use as a blocking control in assays to test for specificity of this VSIG4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VSIG4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur VSIG4

Antigène: VSIG4 (V-Set and Immunoglobulin Domain-Containing Protein 4 (VSIG4))

Autre désignation: VSIG4 (VSIG4 Produits)

Synonymes: anticorps DKFZp468O0322, anticorps CRIg, anticorps Z39IG, anticorps A530061A11, anticorps BC025105, anticorps V-set and immunoglobulin domain containing 4, anticorps VSIG4, anticorps Vsig4

Sujet: T cell activation by APCs is positively and negatively regulated by members of the B7 family. VSIG4 is a strong negative regulator of murine and human T cell proliferation and IL-2 production.

Poids moléculaire: 44 kDa (MW of target protein)