CHST7 anticorps

N° du produit ABIN630479

Détail du produit anti-CHST7 anticorps

Antigène: CHST7 (Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 7 (CHST7))

Reactivité: Souris, Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHST7 est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: CHST7 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLGVLVPLLRDPGLNLKVVQLFRDPRAVHNSRLKSRQGLLRESIQVLRTR

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHST7 Blocking Peptide, catalog no. 33R-2045, is also available for use as a blocking control in assays to test for specificity of this CHST7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHST7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHST7

Antigène: CHST7 (Carbohydrate (N-Acetylglucosamine 6-O) Sulfotransferase 7 (CHST7))

Autre désignation: CHST7 (CHST7 Produits)

Synonymes: anticorps MGC130614, anticorps C6ST-2, anticorps GST-5, anticorps Gn6st-4, anticorps 2600013M07Rik, anticorps GST5, anticorps carbohydrate sulfotransferase 7, anticorps carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 7 L homeolog, anticorps carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 7, anticorps carbohydrate (N-acetylglucosamino) sulfotransferase 7, anticorps CHST7, anticorps chst7.L, anticorps chst7, anticorps Chst7

Sujet: CHST7 belongs to the sulfotransferase family. Sulfotransferases generate sulfated glycosaminoglycan (GAG) moities during chondroitin sulfate biosynthesis. They create considerable structural diversity among chondroitin sulfates by transferring sulfate with remarkable specificity for the underlying oligosaccharide substrate. This protein mainly transfers sulfate to N-acetylgalactosamine. The regulated expression of each member of the family may be an important determinant of sulfated GAGs expression and the associated function of chondroitin sulfates as regulators of many biologic processes.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process