GALNT6 anticorps (N-Term)

N° du produit ABIN630481

Détail du produit anti-GALNT6 anticorps

Antigène: GALNT6 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 6 (GalNAc-T6) (GALNT6))

Épitope: N-Term

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GALNT6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: GALNT6 antibody was raised against the N terminal of GALNT6

Purification: Purified

Immunogène: GALNT6 antibody was raised using the N terminal of GALNT6 corresponding to a region with amino acids MNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDP

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GALNT6 Blocking Peptide, catalog no. 33R-6255, is also available for use as a blocking control in assays to test for specificity of this GALNT6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GALNT6

Antigène: GALNT6 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 6 (GalNAc-T6) (GALNT6))

Autre désignation: GALNT6 (GALNT6 Produits)

Synonymes: anticorps 4632410F13, anticorps AW047994, anticorps GalNAc-T6, anticorps fc23d02, anticorps fc56f12, anticorps wu:fc23d02, anticorps wu:fc56f12, anticorps zgc:77836, anticorps GALNAC-T6, anticorps GalNAcT6, anticorps galnac-t6, anticorps galnact6, anticorps polypeptide N-acetylgalactosaminyltransferase 6, anticorps UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6 (GalNAc-T6), anticorps GALNT6, anticorps Galnt6, anticorps galnt6

Sujet: GALNT6 is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. GALNT6 is capable of glycosylating fibronectin peptide in vitro and is expressed in a fibroblast cell line, indicating that it may be involved in the synthesis of oncofetal fibronectin.

Poids moléculaire: 71 kDa (MW of target protein)