GALNT6 anticorps (N-Term)

N° du produit ABIN630481

Cet anticorps Lapin Polyclonal détecte spécifiquement GALNT6 dans WB et IHC. Il présente une réactivité avec des échantillons de Humain, Souris et Chien.

Aperçu rapide pour GALNT6 anticorps (N-Term) (ABIN630481)

Antigène: GALNT6 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 6 (GalNAc-T6) (GALNT6))

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GALNT6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-GALNT6 anticorps

Épitope: N-Term

Specificité: GALNT6 antibody was raised against the N terminal of GALNT6

Purification: Purified

Immunogène: GALNT6 antibody was raised using the N terminal of GALNT6 corresponding to a region with amino acids MNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDP

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GALNT6 Blocking Peptide, (ABIN5613719), is also available for use as a blocking control in assays to test for specificity of this GALNT6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GALNT6

Antigène: GALNT6 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 6 (GalNAc-T6) (GALNT6))

Autre désignation: GALNT6

Sujet: GALNT6 is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAc-T) family of enzymes. GalNAc-Ts initiate mucin-type O-linked glycosylation in the Golgi apparatus by catalyzing the transfer of GalNAc to serine and threonine residues on target proteins. They are characterized by an N-terminal transmembrane domain, a stem region, a lumenal catalytic domain containing a GT1 motif and Gal/GalNAc transferase motif, and a C-terminal ricin/lectin-like domain. GalNAc-Ts have different, but overlapping, substrate specificities and patterns of expression. GALNT6 is capable of glycosylating fibronectin peptide in vitro and is expressed in a fibroblast cell line, indicating that it may be involved in the synthesis of oncofetal fibronectin.

Poids moléculaire: 71 kDa (MW of target protein)