RHAG anticorps (Middle Region)
-
- Antigène Voir toutes RHAG Anticorps
- RHAG (Rh Family A Glycoprotein (RHAG))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RHAG est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RHAG antibody was raised against the middle region of RHAG
- Purification
- Purified
- Immunogène
- RHAG antibody was raised using the middle region of RHAG corresponding to a region with amino acids FGAVLGKTSPTQMLIMTILEIVFFAHNEYLVSEIFKASDIGASMTIHAFG
- Top Product
- Discover our top product RHAG Anticorps primaire
-
-
- Indications d'application
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RHAG Blocking Peptide, catalog no. 33R-2899, is also available for use as a blocking control in assays to test for specificity of this RHAG antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHAG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RHAG (Rh Family A Glycoprotein (RHAG))
- Autre désignation
- RHAG (RHAG Produits)
- Synonymes
- anticorps CD241, anticorps RH2, anticorps RH50A, anticorps Rh50, anticorps Rh50GP, anticorps SLC42A1, anticorps Rh50A, anticorps Rh-associated glycoprotein, anticorps Rh associated glycoprotein, anticorps Rhesus blood group-associated A glycoprotein, anticorps RHAG, anticorps Rhag
- Sujet
- The Rh blood group antigens are associated with human erythrocyte membrane proteins of approximately 30 kDa, the so-called Rh30 polypeptides. Heterogeneously glycosylated membrane proteins of 50 and 45 kDa, the Rh50 glycoproteins, are coprecipitated with the Rh30 polypeptides on immunoprecipitation with anti-Rh-specific mono- and polyclonal antibodies. The Rh antigens appear to exist as a multisubunit complex of CD47, LW, glycophorin B, and play a critical role in the Rh50 glycoprotein.
- Poids moléculaire
- 45 kDa (MW of target protein)
-