HNF4 gamma anticorps (C-Term)
-
- Antigène Voir toutes HNF4 gamma (HNF4G) Anticorps
- HNF4 gamma (HNF4G) (Hepatocyte Nuclear Factor 4 gamma (HNF4G))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HNF4 gamma est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- HNF4 G antibody was raised against the C terminal of HNF4
- Purification
- Affinity purified
- Immunogène
- HNF4 G antibody was raised using the C terminal of HNF4 corresponding to a region with amino acids QDPLTGQTILLGPMSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQAS
- Top Product
- Discover our top product HNF4G Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HNF4G Blocking Peptide, catalog no. 33R-7508, is also available for use as a blocking control in assays to test for specificity of this HNF4G antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HNF4 gamma (HNF4G) (Hepatocyte Nuclear Factor 4 gamma (HNF4G))
- Autre désignation
- HNF4G (HNF4G Produits)
- Sujet
- HNF4 was first identified as a DNA binding activity in rat liver nuclear extracts and then was found to be an orphan member of the nuclear receptor superfamily. Binding sites for this factor were identified in many tissue-specifically expressed genes, and the protein was found to be essential for early embryonic development in the mouse
- Poids moléculaire
- 50 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway
-