Retinoid X Receptor beta anticorps (N-Term)

N° du produit ABIN630493

Détail du produit anti-Retinoid X Receptor beta anticorps

Antigène: Retinoid X Receptor beta (RXRB) (Retinoid X Receptor, beta (RXRB))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Retinoid X Receptor beta est non-conjugé

Application: Western Blotting (WB)

Specificité: RXRB antibody was raised against the N terminal of RXRB

Purification: Affinity purified

Immunogène: RXRB antibody was raised using the N terminal of RXRB corresponding to a region with amino acids PGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RXRB Blocking Peptide, catalog no. 33R-7103, is also available for use as a blocking control in assays to test for specificity of this RXRB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Retinoid X Receptor beta

Antigène: Retinoid X Receptor beta (RXRB) (Retinoid X Receptor, beta (RXRB))

Autre désignation: RXRB (RXRB Produits)

Synonymes: anticorps DAUDI6, anticorps H-2RIIBP, anticorps NR2B2, anticorps RCoR-1, anticorps RXR-beta, anticorps RXRbeta, anticorps rxrb, anticorps RXRB, anticorps nr2b2, anticorps daudi6, anticorps rcor-1, anticorps h-2riibp, anticorps NR2B2-A, anticorps RXR, anticorps RXRA, anticorps etID309733.19, anticorps rxre, anticorps wu:fb93c09, anticorps AL023085, anticorps Nr2b2, anticorps Rub, anticorps rxrd, anticorps unp286, anticorps retinoid X receptor beta, anticorps retinoid X receptor beta S homeolog, anticorps retinoid x receptor, beta a, anticorps retinoid x receptor, beta b, anticorps RXRB, anticorps Rxrb, anticorps rxrb.S, anticorps rxrb, anticorps rxrba, anticorps rxrbb

Sujet: RXRB is a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). This receptor forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway