Retinoid X Receptor alpha anticorps (N-Term)
-
- Antigène Voir toutes Retinoid X Receptor alpha (RXRA) Anticorps
- Retinoid X Receptor alpha (RXRA) (Retinoid X Receptor, alpha (RXRA))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Retinoid X Receptor alpha est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RXRA antibody was raised against the N terminal of RXRA
- Purification
- Affinity purified
- Immunogène
- RXRA antibody was raised using the N terminal of RXRA corresponding to a region with amino acids DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI
- Top Product
- Discover our top product RXRA Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RXRA Blocking Peptide, catalog no. 33R-2196, is also available for use as a blocking control in assays to test for specificity of this RXRA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Retinoid X Receptor alpha (RXRA) (Retinoid X Receptor, alpha (RXRA))
- Autre désignation
- RXRA (RXRA Produits)
- Synonymes
- anticorps NR2B1, anticorps 9530071D11Rik, anticorps Nr2b1, anticorps RXRalpha1, anticorps RXRalpha, anticorps rxra-A, anticorps xRXR alpha, anticorps xrxra, anticorps RXRA, anticorps RXR alpha, anticorps etID309731.5, anticorps rxr, anticorps rxra, anticorps rxrg, anticorps RXRalpha-B, anticorps retinoid X receptor alpha, anticorps retinoid X receptor alpha L homeolog, anticorps retinoid x receptor, alpha b, anticorps retinoid X receptor, alpha a, anticorps RXRA, anticorps Rxra, anticorps rxra.L, anticorps CpipJ_CPIJ010249, anticorps rxrab, anticorps rxraa
- Sujet
- Retinoid X receptors (RXRs) and retinoic acid receptors (RARs), are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulating their transcription.
- Poids moléculaire
- 51 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Lipid Metabolism by PPARalpha, Hepatitis C
-