Retinoid X Receptor gamma anticorps (N-Term)
-
- Antigène Voir toutes Retinoid X Receptor gamma (RXRG) Anticorps
- Retinoid X Receptor gamma (RXRG) (Retinoid X Receptor, gamma (RXRG))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Retinoid X Receptor gamma est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RXRG antibody was raised against the N terminal of RXRG
- Purification
- Affinity purified
- Immunogène
- RXRG antibody was raised using the N terminal of RXRG corresponding to a region with amino acids NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH
- Top Product
- Discover our top product RXRG Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RXRG Blocking Peptide, catalog no. 33R-6930, is also available for use as a blocking control in assays to test for specificity of this RXRG antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RXRG antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Retinoid X Receptor gamma (RXRG) (Retinoid X Receptor, gamma (RXRG))
- Autre désignation
- RXRG (RXRG Produits)
- Synonymes
- anticorps NR2B3, anticorps RXRC, anticorps zgc:92183, anticorps RXRgamma, anticorps RXRG, anticorps RXR-gamma, anticorps nr2b3, anticorps xrxrg, anticorps rxrc, anticorps Nr2b3, anticorps NR2B1, anticorps RXR, anticorps rxra, anticorps rxrg, anticorps retinoid X receptor gamma, anticorps retinoid X receptor, gamma b, anticorps retinoid X receptor gamma L homeolog, anticorps retinoid x receptor, gamma a, anticorps RXRG, anticorps rxrgb, anticorps rxrg.L, anticorps rxrg, anticorps Rxrg, anticorps RXRGAMMA, anticorps rxrga
- Sujet
- RXRG encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. RXRG is expressed at significantly lower levels in non-small cell lung cancer cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
- Poids moléculaire
- 51 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway
-