HBS1L anticorps
-
- Antigène Voir toutes HBS1L Anticorps
- HBS1L (HBS1-Like (HBS1L))
-
Reactivité
- Hepatitis B Virus (HBV)
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp HBS1L est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- HBS1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids MNHKILVCFADQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLH
- Top Product
- Discover our top product HBS1L Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
HBS1L Blocking Peptide, catalog no. 33R-6246, is also available for use as a blocking control in assays to test for specificity of this HBS1L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HBS0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- HBS1L (HBS1-Like (HBS1L))
- Abstract
- HBS1L Produits
- Classe de substances
- Viral Protein
- Sujet
- HBS1L belongs to the GTP-binding elongation factor family. The HBS1L-MYB intergenic region on chromosome 6q23.3 influences erythrocyte, platelet, and monocyte counts. HBS1L-related genetic variants play a key role in control of fetal hemoglobin levels.
- Poids moléculaire
- 22 kDa (MW of target protein)
-