HBS1L anticorps

N° du produit ABIN630516

Détail du produit anti-HBS1L anticorps

Antigène: HBS1L (HBS1-Like (HBS1L))

Reactivité: Hepatitis B Virus (HBV)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HBS1L est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: HBS1 L antibody was raised using a synthetic peptide corresponding to a region with amino acids MNHKILVCFADQGSGFCITGKIEAGYIQTGDRLLAMPPNETCTVKGITLH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HBS1L Blocking Peptide, catalog no. 33R-6246, is also available for use as a blocking control in assays to test for specificity of this HBS1L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HBS0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HBS1L

Antigène: HBS1L (HBS1-Like (HBS1L))

Abstract: HBS1L Produits

Synonymes: anticorps EF-1a, anticorps ERFS, anticorps HBS1, anticorps HSPC276, anticorps 2810035F15Rik, anticorps AI326327, anticorps eRFS, anticorps wu:fc23c07, anticorps zgc:55400, anticorps EFL1-alpha, anticorps chunp6927, anticorps eef1a, anticorps ef1a, anticorps ik:tdsubc_2a3, anticorps ik:tdsubc_2b3, anticorps tdsubc_2a3, anticorps wu:fa91c07, anticorps wu:fa94b03, anticorps wu:fi13b09, anticorps xx:tdsubc_2a3, anticorps xx:tdsubc_2b3, anticorps Hbs1l, anticorps HBS1 like translational GTPase, anticorps Hbs1-like (S. cerevisiae), anticorps HBS1-like translational GTPase, anticorps elongation factor 1 alpha like protein, anticorps HBS1-like (S. cerevisiae), anticorps eukaryotic translation elongation factor 1 alpha 1, like 1, anticorps HBS1 like translational GTPase L homeolog, anticorps HBS1-like protein, anticorps HBS1L, anticorps Hbs1l, anticorps hbs1l, anticorps SJAG_02601, anticorps eef1a1l1, anticorps hbs1l.L, anticorps LOC101787962

Classe de substances: Viral Protein

Sujet: HBS1L belongs to the GTP-binding elongation factor family. The HBS1L-MYB intergenic region on chromosome 6q23.3 influences erythrocyte, platelet, and monocyte counts. HBS1L-related genetic variants play a key role in control of fetal hemoglobin levels.

Poids moléculaire: 22 kDa (MW of target protein)