DLC1 anticorps (C-Term)

N° du produit ABIN630519

Détail du produit anti-DLC1 anticorps

Antigène: DLC1 (Deleted in Liver Cancer 1 (DLC1))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DLC1 est non-conjugé

Application: Western Blotting (WB)

Specificité: DLC1 antibody was raised against the C terminal of DLC1

Purification: Affinity purified

Immunogène: DLC1 antibody was raised using the C terminal of DLC1 corresponding to a region with amino acids NLAVCLAPSLFHLNTLKRENSSPRVMQRKQSLGKPDQKDLNENLAATQGL

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DLC1 Blocking Peptide, catalog no. 33R-6752, is also available for use as a blocking control in assays to test for specificity of this DLC1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DLC1

Antigène: DLC1 (Deleted in Liver Cancer 1 (DLC1))

Autre désignation: DLC1 (DLC1 Produits)

Synonymes: anticorps ARHGAP7, anticorps HP, anticorps STARD12, anticorps p122-RhoGAP, anticorps rhogap7, anticorps DLC-1, anticorps StARD12, anticorps Dlc-1, anticorps A730069N07Rik, anticorps Arhgap7, anticorps dlc-1, anticorps RhoGAP, anticorps Dlc1, anticorps DLC1 Rho GTPase activating protein, anticorps DLC1 Rho GTPase activating protein S homeolog, anticorps rho GTPase-activating protein 7, anticorps deleted in liver cancer 1, anticorps DLC1, anticorps dlc1.S, anticorps dlc1, anticorps LOC100456847, anticorps Dlc1, anticorps LOC100729904

Sujet: This gene is deleted in the primary tumor of hepatocellular carcinoma. It maps to 8p22-p21.3, a region frequently deleted in solid tumors. It is suggested that this gene is a candidate tumor suppressor gene for human liver cancer, as well as for prostate, lung, colorectal, and breast cancers. DLC1 functions as a GTPase-activating protein specific for Rho and an activator of PLCD1 in vivo and induces morphological changes and detachment through cytoskeletal reorganization.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Tube Formation, Positive Regulation of Endopeptidase Activity