Septin 6 anticorps (N-Term)

N° du produit ABIN630523

Détail du produit anti-Septin 6 anticorps

Antigène: Septin 6 (SEPT6)

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Septin 6 est non-conjugé

Application: Western Blotting (WB)

Specificité: Septin 6 antibody was raised against the N terminal of 40427

Purification: Affinity purified

Immunogène: Septin 6 antibody was raised using the N terminal of 40427 corresponding to a region with amino acids TGLGKSTLMDTLFNTKFEGEPATHTQPGVQLQSNTYDLQESNVRLKLTIV

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of 38961 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Septin 6

Antigène: Septin 6 (SEPT6)

Autre désignation: Septin 6 (SEPT6 Produits)

Synonymes: anticorps SEP2, anticorps SEPT2, anticorps sept11, anticorps SEPT11, anticorps 2810035H17Rik, anticorps C920001C06Rik, anticorps Sep6, anticorps mKIAA0128, anticorps Sep2, anticorps fc54b04, anticorps wu:fb70g05, anticorps wu:fc54b04, anticorps wu:fl76c07, anticorps zgc:66071, anticorps septin-6, anticorps septin 6, anticorps septin 6 L homeolog, anticorps SEPT6, anticorps sept6.L, anticorps Sept6, anticorps sept6, anticorps LOC100220762

Sujet: SEPT6 is a member of the septin family of GTPases. Members of this family are required for cytokinesis.

Poids moléculaire: 12 kDa (MW of target protein)