CCDC46 anticorps (C-Term)

N° du produit ABIN630527

Détail du produit anti-CCDC46 anticorps

Antigène: CCDC46 (Coiled-Coil Domain Containing 46 (CCDC46))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCDC46 est non-conjugé

Application: Western Blotting (WB)

Specificité: CCDC46 antibody was raised against the C terminal of CCDC46

Purification: Affinity purified

Immunogène: CCDC46 antibody was raised using the C terminal of CCDC46 corresponding to a region with amino acids IEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCDC46 Blocking Peptide, catalog no. 33R-3942, is also available for use as a blocking control in assays to test for specificity of this CCDC46 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC46 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCDC46

Antigène: CCDC46 (Coiled-Coil Domain Containing 46 (CCDC46))

Autre désignation: CCDC46 (CCDC46 Produits)

Synonymes: anticorps CCDC46, anticorps MACOCO, anticorps 1700001M19Rik, anticorps 1700029K01Rik, anticorps 8430407H02Rik, anticorps AV043680, anticorps AV207351, anticorps Ccdc46, anticorps Macoco, anticorps RGD1564168, anticorps centrosomal protein 112, anticorps centrosomal protein of 112 kDa, anticorps CEP112, anticorps Cep112, anticorps LOC100523204, anticorps LOC100541423, anticorps cep112

Sujet: CCDC46 is a protein with filament, myosin tail and ATPase domains. Orthologs of the gene exist in mouse, rat and chimp.

Poids moléculaire: 23 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome