CC2D1B anticorps (C-Term)
-
- Antigène Voir toutes CC2D1B Anticorps
- CC2D1B (Coiled-Coil and C2 Domain Containing 1B (CC2D1B))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CC2D1B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- CC2 D2 antibody was raised against the C terminal of CC2 2
- Purification
- Affinity purified
- Immunogène
- CC2 D2 antibody was raised using the C terminal of CC2 2 corresponding to a region with amino acids IVRGMNLPAPPGVTPDDLDAFVRFEFHYPNSDQAQKSKTAVVKNTNSPEF
- Top Product
- Discover our top product CC2D1B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CC2D1B Blocking Peptide, catalog no. 33R-4207, is also available for use as a blocking control in assays to test for specificity of this CC2D1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CC0 0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CC2D1B (Coiled-Coil and C2 Domain Containing 1B (CC2D1B))
- Autre désignation
- CC2D1B (CC2D1B Produits)
- Synonymes
- anticorps MGC68887, anticorps fb71c02, anticorps wu:fb71c02, anticorps A830039B04Rik, anticorps Freud2, anticorps RGD1306630, anticorps coiled-coil and C2 domain containing 1B L homeolog, anticorps coiled-coil and C2 domain containing 1B, anticorps cc2d1b.L, anticorps CC2D1B, anticorps cc2d1b, anticorps Cc2d1b
- Sujet
- CC2D1B belongs to the CC2D1 family. It contains 1 C2 domain. A function of Cc2d1b/Cc2d1a and their Drosophila homologue l(2)gd in D.melanogaster in Notch trafficking have been reported.
- Poids moléculaire
- 41 kDa (MW of target protein)
-