SH3BGR anticorps (N-Term)

N° du produit ABIN630536

Détail du produit anti-SH3BGR anticorps

Antigène: SH3BGR (SH3 Domain Binding Glutamic Acid-Rich Protein (SH3BGR))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SH3BGR est non-conjugé

Application: Western Blotting (WB)

Specificité: SH3 BGR antibody was raised against the N terminal of SH3 GR

Purification: Affinity purified

Immunogène: SH3 BGR antibody was raised using the N terminal of SH3 GR corresponding to a region with amino acids CGDFDSFFSAKEENIIYSFLGLAPPPDSKGSEKAEEGGETEAQKEGSEDV

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SH3BGR Blocking Peptide, catalog no. 33R-1691, is also available for use as a blocking control in assays to test for specificity of this SH3BGR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 GR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SH3BGR

Antigène: SH3BGR (SH3 Domain Binding Glutamic Acid-Rich Protein (SH3BGR))

Autre désignation: SH3BGR (SH3BGR Produits)

Synonymes: anticorps 21-garp, anticorps MGC82574, anticorps Sh3bgr, anticorps ACYPI008600, anticorps RGD1563599, anticorps 21-GARP, anticorps 5430437A18Rik, anticorps SH3 domain binding glutamate-rich protein L homeolog, anticorps SH3 domain binding glutamic acid-rich protein, anticorps SH3 domain binding glutamate-rich protein, anticorps SH3 domain binding glutamate rich protein, anticorps SH3-binding domain glutamic acid-rich protein, anticorps sh3bgr.L, anticorps Sh3bgr, anticorps SH3BGR

Sujet: SH3BGR gene maps to the DS-CHD region and is a potential candidate for the pathogenesis of CHD.

Poids moléculaire: 26 kDa (MW of target protein)