LOC441956 anticorps (N-Term)

N° du produit ABIN630537

Détail du produit anti-LOC441956 anticorps

Antigène: LOC441956 (Hypothetical LOC441956 (LOC441956))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Application: Western Blotting (WB)

Specificité: LOC441956 antibody was raised against the N terminal of LOC441956

Purification: Affinity purified

Immunogène: LOC441956 antibody was raised using the N terminal of LOC441956 corresponding to a region with amino acids APEDPASLRHGLWHQRTQPLAPWTMAAEDPAPRILDYGSRGPSLPASWTK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LOC441956 Blocking Peptide, catalog no. 33R-1418, is also available for use as a blocking control in assays to test for specificity of this LOC441956 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOC441956 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LOC441956

Antigène: LOC441956 (Hypothetical LOC441956 (LOC441956))

Autre désignation: LOC441956 (LOC441956 Produits)

Sujet: The function of LOC441956 protein has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 15 kDa (MW of target protein)