LRRC28 anticorps (N-Term)

N° du produit ABIN630553

Détail du produit anti-LRRC28 anticorps

Antigène: LRRC28 (Leucine Rich Repeat Containing 28 (LRRC28))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LRRC28 est non-conjugé

Application: Western Blotting (WB)

Specificité: LRRC28 antibody was raised against the N terminal of LRRC28

Purification: Affinity purified

Immunogène: LRRC28 antibody was raised using the N terminal of LRRC28 corresponding to a region with amino acids KDEGLQYLERLYMKRNSLTSLPENLAQKLPNLVELYLHSNNIVVVPEAIG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LRRC28 Blocking Peptide, catalog no. 33R-4280, is also available for use as a blocking control in assays to test for specificity of this LRRC28 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LRRC28

Antigène: LRRC28 (Leucine Rich Repeat Containing 28 (LRRC28))

Autre désignation: LRRC28 (LRRC28 Produits)

Synonymes: anticorps MGC69360, anticorps 1300004K21Rik, anticorps 2210012C09Rik, anticorps 2310058O11Rik, anticorps leucine rich repeat containing 28, anticorps lrrc28, anticorps LRRC28, anticorps Lrrc28

Sujet: LRRC28 contains 11 LRR (leucine-rich) repeats. The function of the LRRC28 protein is not known.

Poids moléculaire: 42 kDa (MW of target protein)