IFRD1 anticorps (N-Term)
-
- Antigène Voir toutes IFRD1 Anticorps
- IFRD1 (Interferon Related Developmental Regulator 1 (IFRD1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IFRD1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- IFRD1 antibody was raised against the N terminal of IFRD1
- Purification
- Affinity purified
- Immunogène
- IFRD1 antibody was raised using the N terminal of IFRD1 corresponding to a region with amino acids VQPFSDEDASIETMSHCSGYSDPSSFAEDGPEVLDEEGTQEDLEYKLKGL
- Top Product
- Discover our top product IFRD1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IFRD1 Blocking Peptide, catalog no. 33R-9754, is also available for use as a blocking control in assays to test for specificity of this IFRD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFRD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IFRD1 (Interferon Related Developmental Regulator 1 (IFRD1))
- Autre désignation
- IFRD1 (IFRD1 Produits)
- Sujet
- IFRD1 belongs to the IFRD family.It could play a role in regulating gene activity in the proliferative and/or differentiative pathways induced by NGF. IFRD1 may be an autocrine factor that attenuates or amplifies the initial ligand-induced signal.
- Poids moléculaire
- 50 kDa (MW of target protein)
-