HORMAD2 anticorps (Middle Region)

N° du produit ABIN630566

Détail du produit anti-HORMAD2 anticorps

Antigène: HORMAD2 (HORMA Domain Containing 2 (HORMAD2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HORMAD2 est non-conjugé

Application: Western Blotting (WB)

Specificité: HORMAD2 antibody was raised against the middle region of HORMAD2

Purification: Affinity purified

Immunogène: HORMAD2 antibody was raised using the middle region of HORMAD2 corresponding to a region with amino acids YTDPMGSEKVTEMYQFKFKYTKEGATMDFDSHSSSTSFESGTNNEDIKKA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HORMAD2 Blocking Peptide, catalog no. 33R-10259, is also available for use as a blocking control in assays to test for specificity of this HORMAD2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HORMAD2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HORMAD2

Antigène: HORMAD2 (HORMA Domain Containing 2 (HORMAD2))

Autre désignation: HORMAD2 (HORMAD2 Produits)

Synonymes: anticorps 4930529M09Rik, anticorps HORMA domain containing 2, anticorps HORMAD2, anticorps Hormad2

Sujet: The function of HORMAD protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 35 kDa (MW of target protein)