TSPY-Like 6 anticorps (N-Term)
-
- Antigène Tous les produits TSPY-Like 6 (TSPYL6)
- TSPY-Like 6 (TSPYL6)
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TSPY-Like 6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TSPYL6 antibody was raised against the N terminal of TSPYL6
- Purification
- Affinity purified
- Immunogène
- TSPYL6 antibody was raised using the N terminal of TSPYL6 corresponding to a region with amino acids MSLPESPHSPATLDYALEDPHQGQRSREKSKATEVMADMFDGRLEPIVFP
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TSPYL6 Blocking Peptide, catalog no. 33R-6465, is also available for use as a blocking control in assays to test for specificity of this TSPYL6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPYL6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TSPY-Like 6 (TSPYL6)
- Autre désignation
- TSPYL6 (TSPYL6 Produits)
- Synonymes
- anticorps TSPY like 6, anticorps TSPYL6
- Sujet
- The function of TSPYL6 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 46 kDa (MW of target protein)
-