DONSON anticorps (Middle Region)

N° du produit ABIN630570

Détail du produit anti-DONSON anticorps

Antigène: DONSON (Downstream Neighbor of SON (DONSON))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DONSON est non-conjugé

Application: Western Blotting (WB)

Specificité: DONSON antibody was raised against the middle region of DONSON

Purification: Affinity purified

Immunogène: DONSON antibody was raised using the middle region of DONSON corresponding to a region with amino acids DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DONSON Blocking Peptide, catalog no. 33R-2048, is also available for use as a blocking control in assays to test for specificity of this DONSON antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DONSON antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DONSON

Antigène: DONSON (Downstream Neighbor of SON (DONSON))

Autre désignation: DONSON (DONSON Produits)

Synonymes: anticorps B17, anticorps C21orf60, anticorps C2TA, anticorps 1110025J21Rik, anticorps AI845729, anticorps ORF60, anticorps MGC76196, anticorps downstream neighbor of SON, anticorps downstream neighbor of Son, anticorps protein downstream neighbor of Son, anticorps downstream neighbor of SON L homeolog, anticorps DONSON, anticorps CpipJ_CPIJ018445, anticorps Donson, anticorps donson, anticorps LOC478407, anticorps donson.L

Sujet: This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.

Poids moléculaire: 63 kDa (MW of target protein)