GUK1 anticorps (Middle Region)

N° du produit ABIN630582

Détail du produit anti-GUK1 anticorps

Antigène: GUK1 (Guanylate Kinase 1 (GUK1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GUK1 est non-conjugé

Application: Western Blotting (WB)

Specificité: GUK1 antibody was raised against the middle region of GUK1

Purification: Affinity purified

Immunogène: GUK1 antibody was raised using the middle region of GUK1 corresponding to a region with amino acids IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GUK1 Blocking Peptide, catalog no. 33R-3939, is also available for use as a blocking control in assays to test for specificity of this GUK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GUK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GUK1

Antigène: GUK1 (Guanylate Kinase 1 (GUK1))

Autre désignation: GUK1 (GUK1 Produits)

Synonymes: anticorps GMK, anticorps AA409738, anticorps AL033299, anticorps AL033300, anticorps AV026611, anticorps Gmk, anticorps Guk-1, anticorps guk1, anticorps zgc:73128, anticorps zgc:73217, anticorps gmk, anticorps GUK1, anticorps AGK1, anticorps T11A7.23, anticorps guanylate kinase 1, anticorps DDBDRAFT_0215291, anticorps DDBDRAFT_0230100, anticorps DDB_0215291, anticorps DDB_0230100, anticorps sb:cb295, anticorps zgc:86776, anticorps guanylate kinase 1, anticorps guanylate kinase (GUK1), anticorps guanylate kinase, anticorps guanylate kinase 1b, anticorps guanylate kinase 1 L homeolog, anticorps guanylate kinase 1a, anticorps GUK1, anticorps Guk1, anticorps guk1b, anticorps guk1, anticorps guk1.L, anticorps GK-1, anticorps gmk, anticorps gmkA, anticorps Mrub_2093, anticorps Arnit_0783, anticorps Ndas_3097, anticorps Mesil_1319, anticorps Slip_0854, anticorps Olsu_0986, anticorps Acear_1451, anticorps AOR_1_2886174, anticorps guk1a

Sujet: GUK1 is essential for recycling GMP and indirectly, cGMP.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, ER-Nucleus Signaling, Ribonucleoside Biosynthetic Process