TRIM54 anticorps (N-Term)

N° du produit ABIN630592

Détail du produit anti-TRIM54 anticorps

Antigène: TRIM54 (Tripartite Motif Containing 54 (TRIM54))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRIM54 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRIM54 antibody was raised against the N terminal of TRIM54

Purification: Affinity purified

Immunogène: TRIM54 antibody was raised using the N terminal of TRIM54 corresponding to a region with amino acids NFTVGFKPLLGDAHSMDNLEKQLICPICLEMFSKPVVILPCQHNLCRKCA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRIM54 Blocking Peptide, catalog no. 33R-6692, is also available for use as a blocking control in assays to test for specificity of this TRIM54 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM54 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRIM54

Antigène: TRIM54 (Tripartite Motif Containing 54 (TRIM54))

Autre désignation: TRIM54 (TRIM54 Produits)

Synonymes: anticorps MGC80214, anticorps si:dkey-221h15.2, anticorps DKFZp468L1522, anticorps MURF, anticorps MURF-3, anticorps RNF30, anticorps muRF3, anticorps 4930486E09Rik, anticorps 4930566I02Rik, anticorps MuRF3, anticorps Rnf30, anticorps tripartite motif containing 54, anticorps tripartite motif containing 54 S homeolog, anticorps tripartite motif-containing 54, anticorps TRIM54, anticorps trim54.S, anticorps trim54, anticorps Trim54

Sujet: TRIM54 contains a RING finger motif and is highly similar to the ring finger proteins RNF28/MURF1 and RNF29/MURF2. In vitro studies demonstrated that this protein, RNF28, and RNF29 form heterodimers, which may be important for the regulation of titin kinase and microtubule-dependent signal pathways in striated muscles.

Poids moléculaire: 45 kDa (MW of target protein)