GTPBP10 anticorps

N° du produit ABIN630593

Détail du produit anti-GTPBP10 anticorps

Antigène: GTPBP10 (GTP-Binding Protein 10 (GTPBP10))

Reactivité: Humain, Souris, Rat, Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GTPBP10 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GTPBP10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GTPBP10 Blocking Peptide, catalog no. 33R-2052, is also available for use as a blocking control in assays to test for specificity of this GTPBP10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GTPBP10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GTPBP10

Antigène: GTPBP10 (GTP-Binding Protein 10 (GTPBP10))

Autre désignation: GTPBP10 (GTPBP10 Produits)

Synonymes: anticorps zgc:92334, anticorps ObgH2, anticorps 4930545J22Rik, anticorps BC034507, anticorps Cldn12, anticorps GTP-binding protein 10 (putative), anticorps GTP binding protein 10, anticorps gtpbp10, anticorps GTPBP10, anticorps Gtpbp10

Sujet: Small G proteins, such as GTPBP10, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction.

Poids moléculaire: 43 kDa (MW of target protein)