HPRT1 anticorps

N° du produit ABIN630595

Détail du produit anti-HPRT1 anticorps

Antigène: HPRT1 (Hypoxanthine phosphoribosyltransferase 1 (HPRT1))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HPRT1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: HPRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HPRT1 Blocking Peptide, catalog no. 33R-8866, is also available for use as a blocking control in assays to test for specificity of this HPRT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HPRT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HPRT1

Antigène: HPRT1 (Hypoxanthine phosphoribosyltransferase 1 (HPRT1))

Autre désignation: HPRT1 (HPRT1 Produits)

Synonymes: anticorps HGPRT, anticorps HPRT, anticorps C81579, anticorps HPGRT, anticorps Hprt1, anticorps Hgprtase, anticorps Hprt, anticorps id:ibd1344, anticorps id:ibd5108, anticorps wu:fc10g09, anticorps zgc:56221, anticorps zgc:86608, anticorps hgprt, anticorps hprt, anticorps prtfdc1, anticorps hprt1, anticorps hprt1l, anticorps zgc:55561, anticorps zgc:86771, anticorps hypoxanthine phosphoribosyltransferase 1, anticorps hypoxanthine guanine phosphoribosyl transferase, anticorps hypoxanthine phosphoribosyltransferase 1 L homeolog, anticorps phosphoribosyl transferase domain containing 1, anticorps HPRT1, anticorps Hprt, anticorps Hprt1, anticorps hprt1, anticorps hprt1.L, anticorps prtfdc1

Sujet: HPRT1 has a central role in the generation of purine nucleotides through the purine salvage pathway. HPRT1 catalyzes conversion of hypoxanthine to inosine monophosphate and guanine to guanosine monophosphate via transfer of the 5-phosphoribosyl group from 5-phosphoribosyl 1-pyrophosphate.

Poids moléculaire: 24 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process