CRYGC anticorps (Middle Region)
-
- Antigène Voir toutes CRYGC Anticorps
- CRYGC (Crystallin, gamma C (CRYGC))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CRYGC est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Crystallin Gamma C antibody was raised against the middle region of CRYGC
- Purification
- Affinity purified
- Immunogène
- Crystallin Gamma C antibody was raised using the middle region of CRYGC corresponding to a region with amino acids GLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSE
- Top Product
- Discover our top product CRYGC Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Crystallin Gamma C Blocking Peptide, catalog no. 33R-3422, is also available for use as a blocking control in assays to test for specificity of this Crystallin Gamma C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRYGC antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CRYGC (Crystallin, gamma C (CRYGC))
- Autre désignation
- Crystallin gamma C (CRYGC Produits)
- Synonymes
- anticorps Cryg, anticorps Cryg3, anticorps Len, anticorps CCL, anticorps CRYG3, anticorps CTRCT2, anticorps Cryg-5, anticorps ccl, anticorps cryg3, anticorps MGC84008, anticorps CRYGC, anticorps crystallin, gamma C, anticorps crystallin gamma C, anticorps crystallin gamma C L homeolog, anticorps gamma-crystallin C, anticorps Crygc, anticorps CRYGC, anticorps crygc.L, anticorps LOC100069179
- Sujet
- Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families, Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. They are differentially regulated after early development. Four gamma-crystallin genes (gamma-A through gamma-D) and three pseudogenes (gamma-E, gamma-F, gamma-G) are tandemly organized in a genomic segment as a gene cluster. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation.
- Poids moléculaire
- 21 kDa (MW of target protein)
-