CMAS anticorps (N-Term)

N° du produit ABIN630605

Détail du produit anti-CMAS anticorps

Antigène: CMAS (Cytidine Monophosphate N-Acetylneuraminic Acid Synthetase (CMAS))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CMAS est non-conjugé

Application: Western Blotting (WB)

Specificité: CMAS antibody was raised against the N terminal of CMAS

Purification: Affinity purified

Immunogène: CMAS antibody was raised using the N terminal of CMAS corresponding to a region with amino acids GRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CMAS Blocking Peptide, catalog no. 33R-3531, is also available for use as a blocking control in assays to test for specificity of this CMAS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CMAS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CMAS

Antigène: CMAS (Cytidine Monophosphate N-Acetylneuraminic Acid Synthetase (CMAS))

Autre désignation: CMAS (CMAS Produits)

Synonymes: anticorps CSS, anticorps cmas, anticorps cmas1, anticorps si:dkey-183c2.1, anticorps wu:fj16c12, anticorps zgc:136241, anticorps AW208911, anticorps CMPNeu5Ac, anticorps D6Bwg0250e, anticorps cytidine monophosphate N-acetylneuraminic acid synthetase, anticorps cytidine monophosphate N-acetylneuraminic acid synthetase a, anticorps cytidine monophospho-N-acetylneuraminic acid synthetase, anticorps CMAS, anticorps Cmas, anticorps cmasa, anticorps cmas

Sujet: CMAS is an enzyme that catalyzes the activation of Neu5Ac to Cytidine 5-prime-monophosphate N-acetylneuraminic acid (CMP-Neu5Ac), which provides the substrate required for the addition of sialic acid. Sialic acids of cell surface glycoproteins and glycolipids play a pivotal role in the structure and function of animal tissues. The pattern of cell surface sialylation is highly regulated during embryonic development, and changes with stages of differentiation. Studies of a similar murine protein suggest that this protein localizes to the nucleus.

Poids moléculaire: 48 kDa (MW of target protein)