GAPDH anticorps (Middle Region)

N° du produit ABIN630606

Détail du produit anti-GAPDH anticorps

Antigène: GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GAPDH est non-conjugé

Application: Western Blotting (WB)

Specificité: GAPDH antibody was raised against the middle region of GAPDH

Purification: Affinity purified

Immunogène: GAPDH antibody was raised using the middle region of GAPDH corresponding to a region with amino acids KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GAPDH Blocking Peptide, catalog no. 33R-4241, is also available for use as a blocking control in assays to test for specificity of this GAPDH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAPDH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-GAPDH (ABIN630606)

Kuroda, Ishii, Uematsu, Ohata, Coban, Akira, Aritake, Urade, Morimoto: "Silica crystals and aluminum salts regulate the production of prostaglandin in macrophages via NALP3 inflammasome-independent mechanisms." dans: Immunity, Vol. 34, Issue 4, pp. 514-26, (2011) (PubMed).

Shi, Zhang, Yang, Zhang, Wei: "ROCK1 plays an essential role in the transition from cardiac hypertrophy to failure in mice." dans: Journal of molecular and cellular cardiology, Vol. 49, Issue 5, pp. 819-28, (2010) (PubMed).

Matsumoto, Takahashi, Shiva, Kawanishi, Kremenik, Kato, Yano: "The reduction of voluntary physical activity after poly I:C injection is independent of the effect of poly I:C-induced interferon-beta in mice." dans: Physiology & behavior, Vol. 93, Issue 4-5, pp. 835-41, (2008) (PubMed).

Détails sur GAPDH

Antigène: GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))

Autre désignation: GAPDH (GAPDH Produits)

Synonymes: anticorps G3PD, anticorps GAPD, anticorps Gapd, anticorps BEST:GH12586, anticorps CG12055, anticorps Dmel\\CG12055, anticorps GA3PDH, anticorps GADPH, anticorps GAP, anticorps GAPDH, anticorps GAPDH I, anticorps GAPDH-1, anticorps GAPDH1, anticorps GAPDHI, anticorps Gapdh, anticorps Gapdh-1, anticorps Gapdh43E, anticorps gadph, anticorps gapdh, anticorps gapdh-1, anticorps gh12586, anticorps cb609, anticorps gapd, anticorps mg:bb02e05, anticorps wu:fb33a10, anticorps wu:ft80f05, anticorps KNC-NDS6, anticorps g3pd, anticorps G3PDH, anticorps glyceraldehyde-3-phosphate dehydrogenase, anticorps Glyceraldehyde 3 phosphate dehydrogenase 1, anticorps glyceraldehyde-3-phosphate dehydrogenase S homeolog, anticorps glyceraldehyde-3-phosphate dehydrogenase, type I, anticorps olfactory receptor 8K3, anticorps GAPDH, anticorps Gapdh, anticorps Gapdh1, anticorps gapdh, anticorps gapdh.S, anticorps gapDH, anticorps LOC100404960, anticorps LOC614985

Sujet: GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD).

Poids moléculaire: 36 kDa (MW of target protein)