NASP anticorps
-
- Antigène Voir toutes NASP Anticorps
- NASP (Nuclear Autoantigenic Sperm Protein (Histone-Binding) (NASP))
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NASP est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- NASP antibody was raised using a synthetic peptide corresponding to a region with amino acids KEAEGSSAEYKKEIEELKELLPEIREKIEDAKESQRSGNVAELALKATLV
- Top Product
- Discover our top product NASP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NASP Blocking Peptide, catalog no. 33R-4313, is also available for use as a blocking control in assays to test for specificity of this NASP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NASP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NASP (Nuclear Autoantigenic Sperm Protein (Histone-Binding) (NASP))
- Autre désignation
- NASP (NASP Produits)
- Synonymes
- anticorps FLB7527, anticorps PRO1999, anticorps 5033430J04Rik, anticorps AI131596, anticorps AI317140, anticorps D4Ertd767e, anticorps Epcs32, anticorps Nasp-T, anticorps wu:fd20g12, anticorps zgc:56007, anticorps zgc:85651, anticorps nuclear autoantigenic sperm protein, anticorps nuclear autoantigenic sperm protein (histone-binding), anticorps NASP, anticorps Nasp, anticorps nasp
- Sujet
- This gene encodes a H1 histone binding protein that is involved in transporting histones into the nucleus of dividing cells. Multiple isoforms are encoded by transcript variants of this gene.
- Poids moléculaire
- 49 kDa (MW of target protein)
-