PPP2R5C anticorps (Middle Region)
-
- Antigène Voir toutes PPP2R5C Anticorps
- PPP2R5C (Protein Phosphatase 2, Regulatory Subunit B', gamma (PPP2R5C))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PPP2R5C est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PPP2 R2 antibody was raised against the middle region of PPP2 2
- Purification
- Affinity purified
- Immunogène
- PPP2 R2 antibody was raised using the middle region of PPP2 2 corresponding to a region with amino acids RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGK
- Top Product
- Discover our top product PPP2R5C Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PPP2R5C Blocking Peptide, catalog no. 33R-7903, is also available for use as a blocking control in assays to test for specificity of this PPP2R5C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PPP2R5C (Protein Phosphatase 2, Regulatory Subunit B', gamma (PPP2R5C))
- Autre désignation
- PPP2R5C (PPP2R5C Produits)
- Synonymes
- anticorps B56G, anticorps PR61G, anticorps 2610043M05Rik, anticorps 2700063L20Rik, anticorps AI060890, anticorps AW545884, anticorps C85228, anticorps D12Bwg0916e, anticorps mKIAA0044, anticorps b56g, anticorps ppp2r5c, anticorps si:dkey-241l7.9, anticorps protein phosphatase 2 regulatory subunit B'gamma, anticorps protein phosphatase 2, regulatory subunit B', gamma, anticorps protein phosphatase 2 regulatory subunit B', gamma, anticorps protein phosphatase 2, regulatory subunit B', gamma b, anticorps protein phosphatase 2, regulatory subunit B', gamma a, anticorps PPP2R5C, anticorps Ppp2r5c, anticorps ppp2r5c, anticorps ppp2r5c.L, anticorps ppp2r5cb, anticorps ppp2r5ca
- Sujet
- The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common het
- Poids moléculaire
- 45 kDa (MW of target protein)
- Pathways
- Signalisation PI3K-Akt
-