POLR3F anticorps (Middle Region)
-
- Antigène Voir toutes POLR3F Anticorps
- POLR3F (Polymerase (RNA) III (DNA Directed) Polypeptide F, 39 KDa (POLR3F))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp POLR3F est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- POLR3 F antibody was raised against the middle region of POLR3
- Purification
- Affinity purified
- Immunogène
- POLR3 F antibody was raised using the middle region of POLR3 corresponding to a region with amino acids LNQQCFKFLQSKAETARESKQNPMIQRNSSFASSHEVWKYICELGISKVE
- Top Product
- Discover our top product POLR3F Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
POLR3F Blocking Peptide, catalog no. 33R-5238, is also available for use as a blocking control in assays to test for specificity of this POLR3F antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLR0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- POLR3F (Polymerase (RNA) III (DNA Directed) Polypeptide F, 39 KDa (POLR3F))
- Autre désignation
- POLR3F (POLR3F Produits)
- Synonymes
- anticorps 2810411G20Rik, anticorps 3010019O03Rik, anticorps 3110032A07Rik, anticorps RPC39, anticorps RPC6, anticorps zgc:56299, anticorps zgc:76983, anticorps RNA polymerase III subunit F, anticorps polymerase (RNA) III (DNA directed) polypeptide F, anticorps POLR3F, anticorps Polr3f, anticorps polr3f
- Sujet
- POLR3F is one of more than a dozen subunits forming eukaryotic RNA polymerase III (RNA Pol III), which transcribes 5S ribosomal RNA and tRNA genes. This protein has been shown to bind both TFIIIB90 and TBP, two subunits of RNA polymerase III transcription initiation factor IIIB (TFIIIB). Unlike most of the other RNA Pol III subunits, the encoded protein is unique to this polymerase.
- Poids moléculaire
- 36 kDa (MW of target protein)
-