WDR77 anticorps (N-Term)

N° du produit ABIN630615

Détail du produit anti-WDR77 anticorps

Antigène: WDR77 (WD Repeat Domain 77 (WDR77))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WDR77 est non-conjugé

Application: Western Blotting (WB)

Specificité: WDR77 antibody was raised against the N terminal of WDR77

Purification: Affinity purified

Immunogène: WDR77 antibody was raised using the N terminal of WDR77 corresponding to a region with amino acids MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDR77 Blocking Peptide, catalog no. 33R-6364, is also available for use as a blocking control in assays to test for specificity of this WDR77 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR77 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WDR77

Antigène: WDR77 (WD Repeat Domain 77 (WDR77))

Autre désignation: WDR77 (WDR77 Produits)

Synonymes: anticorps MEP-50, anticorps MEP50, anticorps Nbla10071, anticorps RP11-552M11.3, anticorps p44, anticorps p44/Mep50, anticorps 2610003I18Rik, anticorps 2610312E17Rik, anticorps C79984, anticorps p44/MEP50, anticorps RGD1310479, anticorps mep50, anticorps valois, anticorps WDR77, anticorps zgc:65780, anticorps zgc:77274, anticorps WD repeat domain 77, anticorps WD repeat domain 77 S homeolog, anticorps WDR77, anticorps Wdr77, anticorps wdr77.S, anticorps wdr77

Sujet: WDR77 is the non-catalytic component of the 20S PRMT5-containing methyltransferase complex, which modifies specific arginines to dimethylarginines in several spliceosomal Sm proteins. This modification targets Sm proteins to the survival of motor neurons (SMN) complex for assembly into small nuclear ribonucleoprotein core particles. WDR77 might play a role in transcription regulation.

Poids moléculaire: 38 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization