PIP5KL1 anticorps (Middle Region)
-
- Antigène Voir toutes PIP5KL1 Anticorps
- PIP5KL1 (Phosphatidylinositol-4-Phosphate 5-Kinase-Like 1 (PIP5KL1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PIP5KL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PIP5 KL1 antibody was raised against the middle region of PIP5 L1
- Purification
- Affinity purified
- Immunogène
- PIP5 KL1 antibody was raised using the middle region of PIP5 L1 corresponding to a region with amino acids VLDYSLLIAFQRLHEDERGPGSSLIFRTARSVQGAQSPEESRAQNRRLLP
- Top Product
- Discover our top product PIP5KL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PIP5KL1 Blocking Peptide, catalog no. 33R-9646, is also available for use as a blocking control in assays to test for specificity of this PIP5KL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIP0 L1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PIP5KL1 (Phosphatidylinositol-4-Phosphate 5-Kinase-Like 1 (PIP5KL1))
- Autre désignation
- PIP5KL1 (PIP5KL1 Produits)
- Synonymes
- anticorps PIPKH, anticorps bA203J24.5, anticorps BC028795, anticorps phosphatidylinositol-4-phosphate 5-kinase like 1, anticorps phosphatidylinositol-4-phosphate 5-kinase-like 1, anticorps PIP5KL1, anticorps Pip5kl1
- Sujet
- PIP5KL1 may act as a scaffold to localize and regulate type I PI(4)P 5-kinases to specific compartments within the cell, where they generate PI(4,5)P2 for actin nucleation, signaling and scaffold protein recruitment and conversion to PI(3,4,5)P3.
- Poids moléculaire
- 22 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-