GNAI1 anticorps

N° du produit ABIN630620

Détail du produit anti-GNAI1 anticorps

Antigène: GNAI1 (Guanine Nucleotide Binding Protein (G Protein), alpha Inhibiting Activity Polypeptide 1 (GNAI1))

Reactivité: Humain, Souris, Rat, Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GNAI1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GNAI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids YQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVKTTGIVETHFTFKDLH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GNAI1 Blocking Peptide, catalog no. 33R-10215, is also available for use as a blocking control in assays to test for specificity of this GNAI1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GNAI1

Antigène: GNAI1 (Guanine Nucleotide Binding Protein (G Protein), alpha Inhibiting Activity Polypeptide 1 (GNAI1))

Autre désignation: GNAI1 (GNAI1 Produits)

Synonymes: anticorps AU046200, anticorps Gialpha1, anticorps Gnai-1, anticorps gnai1, anticorps Gi, anticorps BPGTPB, anticorps zgc:63957, anticorps guanine nucleotide binding protein (G protein), alpha inhibiting 1, anticorps G protein subunit alpha i1, anticorps guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1 S homeolog, anticorps guanine nucleotide-binding protein G(i) subunit alpha-1, anticorps guanine nucleotide binding protein (G protein), alpha inhibiting activity polypeptide 1, anticorps Gnai1, anticorps gnai1.S, anticorps GNAI1, anticorps LOC397505, anticorps gnai1

Sujet: Guanine nucleotide-binding proteins (G proteins) form a large family of signal-transducing molecules. They are found as heterotrimers made up of alpha, beta, and gamma subunits. Members of the G protein family have been characterized most extensively on the basis of the alpha subunit, which binds guanine nucleotide, is capable of hydrolyzing GTP, and interacts with specific receptor and effector molecules. The G protein family includes Gs and Gi, the stimulatory and inhibitory GTP-binding regulators of adenylate cyclase, Go, a protein abundant in brain (GNAO1), and transducin-1 (GNAT1) and transducin-2 (GNAT2), proteins involved in phototransduction in retinal rods and cones, respectively.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: G-protein mediated Events