STRADA anticorps (N-Term)
-
- Antigène Voir toutes STRADA Anticorps
- STRADA (STE20-Related Kinase Adaptor alpha (STRADA))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp STRADA est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LYK5 antibody was raised against the N terminal of LYK5
- Purification
- Affinity purified
- Immunogène
- LYK5 antibody was raised using the N terminal of LYK5 corresponding to a region with amino acids MSFLTNDASSESIASFSKQEVMSSFLPEGGCYELLTVIGKGFEDLMTVNL
- Top Product
- Discover our top product STRADA Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LYK5 Blocking Peptide, catalog no. 33R-6420, is also available for use as a blocking control in assays to test for specificity of this LYK5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYK5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- STRADA (STE20-Related Kinase Adaptor alpha (STRADA))
- Autre désignation
- LYK5 (STRADA Produits)
- Synonymes
- anticorps fj99g05, anticorps zgc:56109, anticorps wu:fj99g05, anticorps lyk5, anticorps LYK5, anticorps NY-BR-96, anticorps PMSE, anticorps STRAD, anticorps Stlk, anticorps Lyk5, anticorps 2610019A05Rik, anticorps 6030402H20Rik, anticorps AI480680, anticorps E130112C09Rik, anticorps STE20-related kinase adaptor alpha, anticorps ste20-related kinase adaptor alpha, anticorps STRADA, anticorps strada, anticorps Strada
- Sujet
- LYK5 belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily. It contains 1 protein kinase domain. LYK5 is a pseudokinase which, in complex with CAB39, binds to and activates STK11.
- Poids moléculaire
- 44 kDa (MW of target protein)
- Pathways
- AMPK Signaling
-