PNMA3 anticorps (N-Term)

N° du produit ABIN630623

Détail du produit anti-PNMA3 anticorps

Antigène: PNMA3 (Paraneoplastic Antigen MA3 (PNMA3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PNMA3 est non-conjugé

Application: Western Blotting (WB)

Specificité: PNMA3 antibody was raised against the N terminal of PNMA3

Purification: Affinity purified

Immunogène: PNMA3 antibody was raised using the N terminal of PNMA3 corresponding to a region with amino acids QDIDYALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PNMA3 Blocking Peptide, catalog no. 33R-7501, is also available for use as a blocking control in assays to test for specificity of this PNMA3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNMA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PNMA3

Antigène: PNMA3 (Paraneoplastic Antigen MA3 (PNMA3))

Autre désignation: PNMA3 (PNMA3 Produits)

Synonymes: anticorps MA3, anticorps MA5, anticorps RGD1563752, anticorps PNMA family member 3, anticorps paraneoplastic antigen MA3, anticorps paraneoplastic Ma antigen 3, anticorps PNMA3, anticorps Pnma3

Sujet: This gene is a member of the paraneoplastic antigen MA (PNMA) gene family, whose protein products share homology with retroviral Gag proteins. They are highly expressed in the brain and also in a range of tumors associated with serious neurological phenotypes. PMID:16407312 reports the presence of a functional -1 ribosomal frameshift signal (consisting of a heptanucleotide shift motif followed 3' by a pseudoknot structure) in this gene, however, the frame-shifted product has not been characterized.

Poids moléculaire: 52 kDa (MW of target protein)