SMC2 anticorps (N-Term)

N° du produit ABIN630626

Détail du produit anti-SMC2 anticorps

Antigène: SMC2 (Structural Maintenance of Chromosomes 2 (SMC2))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SMC2 est non-conjugé

Application: Western Blotting (WB)

Specificité: SMC2 antibody was raised against the N terminal of SMC2

Purification: Affinity purified

Immunogène: SMC2 antibody was raised using the N terminal of SMC2 corresponding to a region with amino acids ISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SMC2 Blocking Peptide, catalog no. 33R-4161, is also available for use as a blocking control in assays to test for specificity of this SMC2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SMC2

Antigène: SMC2 (Structural Maintenance of Chromosomes 2 (SMC2))

Autre désignation: SMC2 (SMC2 Produits)

Synonymes: anticorps CAP-E, anticorps CAPE, anticorps SMC-2, anticorps SMC2L1, anticorps 5730502P04Rik, anticorps AI255214, anticorps AW545314, anticorps Fin16, anticorps Smc2l1, anticorps fb92e05, anticorps wu:fb92e05, anticorps zeh1628, anticorps zgc:55326, anticorps xcap-e, anticorps SCII, anticorps structural maintenance of chromosomes 2, anticorps structural maintenance of chromosomes 2 L homeolog, anticorps SMC2, anticorps Smc2, anticorps smc2, anticorps smc2.L

Sujet: SMC2 is the central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases.

Poids moléculaire: 32 kDa (MW of target protein)