VASH1 anticorps (N-Term)
-
- Antigène Voir toutes VASH1 Anticorps
- VASH1 (Vasohibin 1 (VASH1))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp VASH1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Vasohibin 1 antibody was raised against the N terminal of VASH1
- Purification
- Affinity purified
- Immunogène
- Vasohibin 1 antibody was raised using the N terminal of VASH1 corresponding to a region with amino acids ATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPER
- Top Product
- Discover our top product VASH1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Vasohibin 1 Blocking Peptide, catalog no. 33R-1576, is also available for use as a blocking control in assays to test for specificity of this Vasohibin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VASH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- VASH1 (Vasohibin 1 (VASH1))
- Autre désignation
- Vasohibin 1 (VASH1 Produits)
- Synonymes
- anticorps KIAA1036, anticorps AI834978, anticorps D930046M13Rik, anticorps G630009D10Rik, anticorps RGD1564082, anticorps vasohibin 1, anticorps VASH1, anticorps vash1, anticorps Vash1
- Sujet
- VASH1 is the angiogenesis inhibitor. It inhibits migration, proliferation and network formation by endothelial cells as well as angiogenesis. This inhibitory effect is selective to endothelial cells as it does not affect the migration of smooth muscle cells or fibroblasts. VASH1 does not affect the proliferation of cancer cells in vitro, but inhibits tumor growth and tumor angiogenesis. It acts in an autocrine manner. VASH1 inhibits artery neointimal formation and macrophage infiltration.
- Poids moléculaire
- 41 kDa (MW of target protein)
-