ASF1B anticorps
-
- Antigène Voir toutes ASF1B Anticorps
- ASF1B (ASF1 Anti-Silencing Function 1 Homolog B (ASF1B))
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ASF1B est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ASF1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH
- Top Product
- Discover our top product ASF1B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ASF1B Blocking Peptide, catalog no. 33R-10123, is also available for use as a blocking control in assays to test for specificity of this ASF1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASF0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ASF1B (ASF1 Anti-Silencing Function 1 Homolog B (ASF1B))
- Autre désignation
- ASF1B (ASF1B Produits)
- Sujet
- ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.
- Poids moléculaire
- 22 kDa (MW of target protein)
- Pathways
- Regulation of Cell Size
-