ASF1B anticorps

N° du produit ABIN630638

Détail du produit anti-ASF1B anticorps

Antigène: ASF1B (ASF1 Anti-Silencing Function 1 Homolog B (ASF1B))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ASF1B est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ASF1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids YHGQEFIRVGYYVNNEYLNPELRENPPMKPDFSQLQRNILASNPRVTRFH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ASF1B Blocking Peptide, catalog no. 33R-10123, is also available for use as a blocking control in assays to test for specificity of this ASF1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ASF1B

Antigène: ASF1B (ASF1 Anti-Silencing Function 1 Homolog B (ASF1B))

Autre désignation: ASF1B (ASF1B Produits)

Synonymes: anticorps CIA-II, anticorps asf1-b, anticorps asf1a, anticorps asf1a-b, anticorps asf1ab, anticorps cia-ii, anticorps 1700003K02Rik, anticorps AA409591, anticorps asf1b, anticorps fc68a10, anticorps wu:fc68a10, anticorps zgc:77178, anticorps ASF1B, anticorps F16F17.110, anticorps F16F17_110, anticorps SGA01, anticorps SGA1, anticorps anti- silencing function 1b, anticorps asf1, anticorps MGC89345, anticorps asb1bb, anticorps wu:fb20g03, anticorps zgc:76977, anticorps anti-silencing function 1B histone chaperone, anticorps anti-silencing function 1B histone chaperone L homeolog, anticorps anti-silencing function 1Ba histone chaperone, anticorps anti- silencing function 1b, anticorps histone chaperone ASF1B, anticorps anti-silencing function 1Bb histone chaperone, anticorps ASF1B, anticorps asf1b.L, anticorps Asf1b, anticorps asf1ba, anticorps LOC9304878, anticorps asf1b, anticorps asf1bb

Sujet: ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases, and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Regulation of Cell Size