STRAP anticorps (N-Term)
-
- Antigène Voir toutes STRAP Anticorps
- STRAP (Serine/threonine Kinase Receptor Associated Protein (STRAP))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp STRAP est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- STRAP antibody was raised against the N terminal of STRAP
- Purification
- Affinity purified
- Immunogène
- STRAP antibody was raised using the N terminal of STRAP corresponding to a region with amino acids HIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEISGHTSGIKKAL
- Top Product
- Discover our top product STRAP Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
STRAP Blocking Peptide, catalog no. 33R-3756, is also available for use as a blocking control in assays to test for specificity of this STRAP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STRAP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- STRAP (Serine/threonine Kinase Receptor Associated Protein (STRAP))
- Autre désignation
- STRAP (STRAP Produits)
- Synonymes
- anticorps MAWD, anticorps PT-WD, anticorps UNRIP, anticorps zgc:56677, anticorps zgc:77604, anticorps mawd, anticorps pt-wd, anticorps unrip, anticorps AW557906, anticorps C78091, anticorps C79202, anticorps Unrip, anticorps serine/threonine kinase receptor associated protein, anticorps tetratricopeptide repeat domain 5, anticorps serine/threonine kinase receptor associated protein L homeolog, anticorps serine/threonine kinase receptor associated protein S homeolog, anticorps STRAP, anticorps TTC5, anticorps strap, anticorps strap.L, anticorps strap.S, anticorps Strap
- Sujet
- The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. STRAP may play a role in the cellular distribution of the SMN complex.
- Poids moléculaire
- 38 kDa (MW of target protein)
-